PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy016161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family CAMTA
Protein Properties Length: 403aa    MW: 45043.9 Da    PI: 4.9309
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59547770PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-194.31.1e-2916257118
       CG-1  57 wkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                wkkkkdgktv+E+he+LKvg+ e +++yYah+++np f rrcywlL+++le+ivlvhy+e++
  Ahy016161   1 WKKKKDGKTVKEAHEHLKVGNEERIHVYYAHGQDNPGFVRRCYWLLDKSLEHIVLVHYRETQ 62 
                ***********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143747.625167IPR005559CG-1 DNA-binding domain
SMARTSM010765.3E-15162IPR005559CG-1 DNA-binding domain
PfamPF038594.7E-24160IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.109.1E-6250364IPR013783Immunoglobulin-like fold
SuperFamilySSF812961.09E-16276362IPR014756Immunoglobulin E-set
PfamPF018331.3E-4277361IPR002909IPT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
WKKKKDGKTV KEAHEHLKVG NEERIHVYYA HGQDNPGFVR RCYWLLDKSL EHIVLVHYRE  60
TQELQASPAA PINSHSSSGS DPNAPWILSE EIDSGIKTTN AGEINNNITV KSHEQRLHEI  120
NTLEWDDLVV ANDPNTSTIN GGGKVPHFDQ QNQSNLSNQV ANNLSAEIPS FDNLTQPIAG  180
SHTFPENLNL QTDNQMNPNE QINHNVLVNG VFLDTLGNGG LQSQDSFGMW VNHMLSDSPC  240
SVDESAVESS VSSIHESYSS LVGDDKQTSL PEQVFNLTDV SPAWVPSTEK SKILVTGFFH  300
KDADLSKSNL LCVCGDVSVP VECVQVGVYR CWVPPHSPGF VNLYLSFDGH KPISQVVNFE  360
YRTPILHDPA AFMENNDNWD KFQFEMRLSY LLFTKKNSLD VFS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016197980.10.0PREDICTED: calmodulin-binding transcription activator 5 isoform X3
SwissprotO234631e-115CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLA0A0R0JD920.0A0A0R0JD92_SOYBN; Uncharacterized protein
STRINGGLYMA07G37090.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.11e-110calmodulin binding;transcription regulators